PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Oropetium_20150105_06229A
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Cynodonteae; Tripogoninae; Oropetium
Family MYB
Protein Properties Length: 371aa    MW: 39034 Da    PI: 9.5644
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Oropetium_20150105_06229AgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding60.53.5e-192065147
                               TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
            Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                               +g+W++eEde l ++v+++G ++W++I+r ++ gR++k+c++rw + 
  Oropetium_20150105_06229A 20 KGPWSPEEDEALQRLVARHGARNWSLISRSIP-GRSGKSCRLRWCNQ 65
                               79******************************.***********985 PP

2Myb_DNA-binding53.45.8e-1774116347
                                SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
            Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                                ++T+eEd+ +++a++++G++ W+tIar +  gRt++ +k++w++ 
  Oropetium_20150105_06229A  74 PFTPEEDDTILRAHARFGNK-WATIARLLS-GRTDNAIKNHWNST 116
                                89******************.*********.***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129426.5951570IPR017930Myb domain
SuperFamilySSF466895.24E-3217113IPR009057Homeodomain-like
SMARTSM007178.3E-171968IPR001005SANT/Myb domain
PfamPF002492.5E-182065IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.607.3E-262173IPR009057Homeodomain-like
CDDcd001676.48E-162264No hitNo description
SMARTSM007171.7E-1471119IPR001005SANT/Myb domain
PROSITE profilePS5129420.33872121IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.9E-2374120IPR009057Homeodomain-like
CDDcd001671.50E-1174117No hitNo description
PfamPF002491.9E-1474116IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009723Biological Processresponse to ethylene
GO:0009737Biological Processresponse to abscisic acid
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0010200Biological Processresponse to chitin
GO:0046686Biological Processresponse to cadmium ion
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 371 aa     Download sequence    Send to blast
MASPSCRGGG GGGKDADRIK GPWSPEEDEA LQRLVARHGA RNWSLISRSI PGRSGKSCRL  60
RWCNQLSPQV EHRPFTPEED DTILRAHARF GNKWATIARL LSGRTDNAIK NHWNSTLKRK  120
YYAAAAASGG GGPGGAAAAD LAPVEDEEEM RRPLKRTSSD GHPGLCFSPG SPSGSDLSES  180
SHHSLPSVMP SSSPAAAAAA APASTSQQQQ QQQHVYRPVP RAGGVVVLPP SPPQTTAPPA  240
AAPPTTSLSL SLSLPGLDRP DPSLAPPPPP TAHVQHVQVP QHPPATPPSQ MPPPPLPTLQ  300
AQQSLPFQLH PPATTLAQPP APAPFSSEFL SMMQEMIRIE VRNYMSGSGL DPRSGGAATT  360
QRMMGMAKIE *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A6e-39171204107B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00476DAPTransfer from AT4G37260Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHF6794251e-137HF679425.1 Saccharum hybrid cultivar Co 86032 mRNA for ScMYB19 protein.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001151336.11e-144sucrose responsive element binding protein
TrEMBLB6TZ851e-144B6TZ85_MAIZE; Sucrose responsive element binding protein
STRINGGRMZM2G050550_P011e-143(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP78938154
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G23290.16e-63myb domain protein 70